Affiliate Genie Review

14 comments

in Affiliate Marketing

affiliategeniereview Affiliate Genie Review

Its no secret that wordpress built sites have some of the worst conversion rates for affiliate marketing. This is something not talked about or addressed often by many of the top affiliate marketers cause its often a closely guarded secret and few are willing to really tell marketers what the missing element is.

This is why I am really excited that one of my favorite marketers, and a guy who really looks out for smaller affiliates has put something very unique to help marketers build clean, high converting affiliate sites easily, without all the fussing around and tweaking the many beginners have to go through to get a decent looking site

Affiliate Genie is a new affiliate site building tool from one of my favorite and respected online marketing guru’s Chris Rempel.

We are going to look at what Affiliate Genie does, and how it can help you if as an affiliate marketer build high converting affiliate sites.

Note: We are not here telling folks to go out and get anything here, because we realize that everyone is at at different stage in their IM and may not be ready for yet another product, without really needing it or mastering the basics first.

What is Affiliate Genie?

One of the problems marketers are having is creating a site that really entices the buyer type and has a high click through rate. Many of the top gurus have spent allot of time mastering the fundamentals and have tested what works, but these are some of the most closely guarded secrets and is often not talked about.

What Chris Rempel, creator of Affiliate Genie has done, is create software that installs easily on your domain and allows to upload a professional looking and high converting affiliate structured site on your domain. Affiliate Genie does this with ease, so all you truly need to focus is on writing content and finding the right offers to promote.

Quick Snapshot of Software In Action

affilaitegeniesoftwarereview Affiliate Genie Reviewaffilaitegeniesoftwaresnapshot Affiliate Genie Review

affilaitesitebuilderaffilaitegeniereview1 Affiliate Genie Review

Features of Affiliate Genie

1. Ability to Create unique content in profitable markets that targets people who are on the verge of making of buying.

2. Display affiliate offers that offers a solution to your visitor’s problem and easily creates an unlimited product reviews.

4. Easily add product images or videos

5. Affiliate Genie builds’ your site in a way that has been proven to give high conversion and click through rates and is how Chris has built up his success online.

6. Quick to install on your domain, and you can repeat the process much more easily than you would when building a wordpress structured site.

7. 60 money back guarantee offer.

8. NO Monthly Membership chrisrempelaffilaitegeniereview Affiliate Genie Review

affilategenieaffilaitewebsitecreatortool Affiliate Genie Review Check out a quick video tutorial here and see if affiliate genie is right for you.

>>Click Here To Visit  Chris Rempel’s Affiliate Genie<<

 

chrisremelproducts Affiliate Genie Review Chris is one of favorite super affiliates that really tries to help marketers. For those of you looking for more his products, please check out my Chris Rempel’s Products Page. chrisrempelproducts2 Affiliate Genie Review

{ 6 comments… read them below or add one }

Bobby Walker December 21, 2009 at 8:04 pm

I love reading web sites about affiliate marketing. I have been learning about Google Adsense lately. Seems like there is something new to learn every day. Thanks again for a very informative site! Visit my site if you’d like to read more.

Affiliate Marketing December 25, 2009 at 8:38 pm

Thank you! I would now go on this blog every day and check for updates!

Robt Catherwood December 26, 2009 at 7:07 am

Hello i am so delighted I found your blog, I really found you by mistake, while I was searching Yahoo for something else, Anyway I am here now and would just like to say thanks for a tremendous blog posting and a all round interesting blog (I also love the theme/design), I do not have time to read it all at the moment but I have bookmarked it and also added your RSS feeds, so when I have time I will be back to read more,

Janardhanaya December 29, 2009 at 1:10 pm

amazing stuff thanx :)

http://software.webricher.com/why-is-it-important-to-read-copy-dvd-software-reviews.html January 1, 2010 at 3:06 pm

Very useful information. Thanks for this post. I’ll be sure to come back again. P.S: I’ve bookmark your site as well.

Quick Facts October 29, 2010 at 11:40 pm

You you could change the post subject Ask-Tony.com | Affiliate Genie Review to something more specific for your blog post you create. I loved the the writing withal.

Leave a Comment

{ 8 trackbacks }

Previous post:

Next post: